"git@developer.sourcefind.cn:OpenDAS/openfold.git" did not exist on "16af434172e95532b056896cc92336810b004674"
Commit 1165d9eb authored by jnwei's avatar jnwei
Browse files

edit starting sequence in notebook

parent d4acbe6e
...@@ -49,27 +49,15 @@ ...@@ -49,27 +49,15 @@
}, },
{ {
"cell_type": "code", "cell_type": "code",
"execution_count": 1, "execution_count": null,
"metadata": { "metadata": {
"id": "rowN0bVYLe9n", "id": "rowN0bVYLe9n"
"colab": {
"base_uri": "https://localhost:8080/"
},
"outputId": "8a4c9c7d-a555-460f-de39-d6aff2272d36"
}, },
"outputs": [ "outputs": [],
{
"output_type": "stream",
"name": "stdout",
"text": [
"Length of input sequence : 716\n"
]
}
],
"source": [ "source": [
"#@markdown ### Enter the amino acid sequence to fold ⬇️\n", "#@markdown ### Enter the amino acid sequence to fold ⬇️\n",
"#@markdown For multiple sequences, separate sequences with a colon `:`\n", "#@markdown For multiple sequences, separate sequences with a colon `:`\n",
"input_sequence = 'MVDATRVPMDERFRTLKKKLEEGMVFTEYEQIPKKKANGIFSTAALPENAERSRIREVVPYEENRVELIPTKENNTGYINASHIKVVVGGAEWHYIATQGPLPHTCHDFWQMVWEQGVNVIAMVTAEEEGGRTKSHRYWPKLGSKHSSATYGKFKVTTKFRTDSVCYATTGLKVKHLLSGQERTVWHLQYTDWPDHGCPEDVQGFLSYLEEIQSVRRHTNSMLEGTKNRHPPIVVHCSAGVGRTGVLILSELMIYCLEHNEKVEVPMMLRLLREQRMFMIQTIAQYKFVYQVLIQFLQNSRLI:MVDATRVPMDERFRTLKKKLEEGMVFTEYEQIPKKKANGIFSTAALPENAERSRIREVVPYEENRVELIPTKENNTGYINASHIKVVVGGAEWHYIATQGPLPHTCHDFWQMVWEQGVNVIAMVTAEEEGGRTKSHRYWPKLGSKHSSATYGKFKVTTKFRTDSVCYATTGLKVKHLLSGQERTVWHLQYTDWPDHGCPEDVQGFLSYLEEIQSVRRHTNSMLEGTKNRHPPIVVHCSAGVGRTGVLILSELMIYCLEHNEKVEVPMMLRLLREQRMFMIQTIAQYKFVYQVLIQFLQNSRLI:GHMAEPQRHTMLCMCCKCEARIELVVESSADDLRAFQQLFLNTLSFVCPWCASQQ:GHMAEPQRHTMLCMCCKCEARIELVVESSADDLRAFQQLFLNTLSFVCPWCASQQ' #@param {type:\"string\"}\n", "input_sequence = 'MKLKQVADKLEEVASKLYHNANELARVAKLLGER:MKLKQVADKLEEVASKLYHNANELARVAKLLGER: MKLKQVADKLEEVASKLYHNANELARVAKLLGER:MKLKQVADKLEEVASKLYHNANELARVAKLLGER' #@param {type:\"string\"}\n",
"\n", "\n",
"#@markdown ### Configure the model ⬇️\n", "#@markdown ### Configure the model ⬇️\n",
"\n", "\n",
...@@ -107,7 +95,7 @@ ...@@ -107,7 +95,7 @@
}, },
{ {
"cell_type": "code", "cell_type": "code",
"execution_count": 2, "execution_count": null,
"metadata": { "metadata": {
"id": "woIxeCPygt7K" "id": "woIxeCPygt7K"
}, },
...@@ -159,7 +147,7 @@ ...@@ -159,7 +147,7 @@
}, },
{ {
"cell_type": "code", "cell_type": "code",
"execution_count": 3, "execution_count": null,
"metadata": { "metadata": {
"id": "VzJ5iMjTtoZw" "id": "VzJ5iMjTtoZw"
}, },
...@@ -208,7 +196,7 @@ ...@@ -208,7 +196,7 @@
}, },
{ {
"cell_type": "code", "cell_type": "code",
"execution_count": 4, "execution_count": null,
"metadata": { "metadata": {
"id": "_FpxxMo-mvcP" "id": "_FpxxMo-mvcP"
}, },
...@@ -914,7 +902,8 @@ ...@@ -914,7 +902,8 @@
"metadata": { "metadata": {
"colab": { "colab": {
"provenance": [], "provenance": [],
"gpuType": "T4" "gpuType": "T4",
"toc_visible": true
}, },
"kernelspec": { "kernelspec": {
"display_name": "Python 3", "display_name": "Python 3",
......
Markdown is supported
0% or .
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment