Commit 1165d9eb authored by jnwei's avatar jnwei
Browse files

edit starting sequence in notebook

parent d4acbe6e
......@@ -49,27 +49,15 @@
},
{
"cell_type": "code",
"execution_count": 1,
"execution_count": null,
"metadata": {
"id": "rowN0bVYLe9n",
"colab": {
"base_uri": "https://localhost:8080/"
},
"outputId": "8a4c9c7d-a555-460f-de39-d6aff2272d36"
"id": "rowN0bVYLe9n"
},
"outputs": [
{
"output_type": "stream",
"name": "stdout",
"text": [
"Length of input sequence : 716\n"
]
}
],
"outputs": [],
"source": [
"#@markdown ### Enter the amino acid sequence to fold ⬇️\n",
"#@markdown For multiple sequences, separate sequences with a colon `:`\n",
"input_sequence = 'MVDATRVPMDERFRTLKKKLEEGMVFTEYEQIPKKKANGIFSTAALPENAERSRIREVVPYEENRVELIPTKENNTGYINASHIKVVVGGAEWHYIATQGPLPHTCHDFWQMVWEQGVNVIAMVTAEEEGGRTKSHRYWPKLGSKHSSATYGKFKVTTKFRTDSVCYATTGLKVKHLLSGQERTVWHLQYTDWPDHGCPEDVQGFLSYLEEIQSVRRHTNSMLEGTKNRHPPIVVHCSAGVGRTGVLILSELMIYCLEHNEKVEVPMMLRLLREQRMFMIQTIAQYKFVYQVLIQFLQNSRLI:MVDATRVPMDERFRTLKKKLEEGMVFTEYEQIPKKKANGIFSTAALPENAERSRIREVVPYEENRVELIPTKENNTGYINASHIKVVVGGAEWHYIATQGPLPHTCHDFWQMVWEQGVNVIAMVTAEEEGGRTKSHRYWPKLGSKHSSATYGKFKVTTKFRTDSVCYATTGLKVKHLLSGQERTVWHLQYTDWPDHGCPEDVQGFLSYLEEIQSVRRHTNSMLEGTKNRHPPIVVHCSAGVGRTGVLILSELMIYCLEHNEKVEVPMMLRLLREQRMFMIQTIAQYKFVYQVLIQFLQNSRLI:GHMAEPQRHTMLCMCCKCEARIELVVESSADDLRAFQQLFLNTLSFVCPWCASQQ:GHMAEPQRHTMLCMCCKCEARIELVVESSADDLRAFQQLFLNTLSFVCPWCASQQ' #@param {type:\"string\"}\n",
"input_sequence = 'MKLKQVADKLEEVASKLYHNANELARVAKLLGER:MKLKQVADKLEEVASKLYHNANELARVAKLLGER: MKLKQVADKLEEVASKLYHNANELARVAKLLGER:MKLKQVADKLEEVASKLYHNANELARVAKLLGER' #@param {type:\"string\"}\n",
"\n",
"#@markdown ### Configure the model ⬇️\n",
"\n",
......@@ -107,7 +95,7 @@
},
{
"cell_type": "code",
"execution_count": 2,
"execution_count": null,
"metadata": {
"id": "woIxeCPygt7K"
},
......@@ -159,7 +147,7 @@
},
{
"cell_type": "code",
"execution_count": 3,
"execution_count": null,
"metadata": {
"id": "VzJ5iMjTtoZw"
},
......@@ -208,7 +196,7 @@
},
{
"cell_type": "code",
"execution_count": 4,
"execution_count": null,
"metadata": {
"id": "_FpxxMo-mvcP"
},
......@@ -914,7 +902,8 @@
"metadata": {
"colab": {
"provenance": [],
"gpuType": "T4"
"gpuType": "T4",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
......
Markdown is supported
0% or .
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment