"git@developer.sourcefind.cn:OpenDAS/colossalai.git" did not exist on "80eba05b0abc0ce24f02254cbe2c7b8f9ff5d688"
Commit cc565fde authored by jnwei's avatar jnwei Committed by Jennifer Wei
Browse files

Adds example directory

parent 0b30bb85
...@@ -11,7 +11,7 @@ We currently offer three modes of inference prediction: ...@@ -11,7 +11,7 @@ We currently offer three modes of inference prediction:
- Single Sequence (Soloseq) - Single Sequence (Soloseq)
This guide will focus on monomer prediction, the next sections will describe [Multimer](Multimer_Inference.md) and [Single Sequence](Single_Sequence_Inference.md) prediction. This guide will focus on monomer prediction, the next sections will describe [Multimer](Multimer_Inference.md) and [Single Sequence](Single_Sequence_Inference.md) prediction.
`
### Pre-requisites: ### Pre-requisites:
- OpenFold Conda Environment. See [OpenFold Installation](Installation.md) for instructions on how to build this environment. - OpenFold Conda Environment. See [OpenFold Installation](Installation.md) for instructions on how to build this environment.
...@@ -22,6 +22,7 @@ This guide will focus on monomer prediction, the next sections will describe [Mu ...@@ -22,6 +22,7 @@ This guide will focus on monomer prediction, the next sections will describe [Mu
The script [`run_pretrained_openfold.py`](https://github.com/aqlaboratory/openfold/blob/main/run_pretrained_openfold.py) performs model inference. We will go through the steps of how to use this script. The script [`run_pretrained_openfold.py`](https://github.com/aqlaboratory/openfold/blob/main/run_pretrained_openfold.py) performs model inference. We will go through the steps of how to use this script.
An example directory for performing infernce on [PDB:6KWC](https://www.rcsb.org/structure/6KWC) is provided [here](https://github.com/aqlaboratory/openfold/tree/main/examples/monomer). We refer to this example directory for the below examples.
### Download Model Parameters ### Download Model Parameters
...@@ -57,24 +58,23 @@ The following command performs a sequence alignment against the OpenProteinSet d ...@@ -57,24 +58,23 @@ The following command performs a sequence alignment against the OpenProteinSet d
``` ```
python3 run_pretrained_openfold.py \ python3 run_pretrained_openfold.py \
${INPUT_FASTA_DIR} \ $INPUT_FASTA_DIR \
${TEMPLATE_MMCIF_DIR} $TEMPLATE_MMCIF_DIR
--output_dir ${OUTPUT_DIR} \ --output_dir $OUTPUT_DIR \
--config_preset model_1_ptm \ --config_preset model_1_ptm \
--uniref90_database_path ${BASE_DATA_DIR}/uniref90 \ --uniref90_database_path $BASE_DATA_DIR/uniref90 \
--mgnify_database_path ${BASE_DATA_DIR}/mgnify/mgy_clusters_2018_12.fa \ --mgnify_database_path $BASE_DATA_DIR/mgnify/mgy_clusters_2018_12.fa \
--pdb70_database_path ${BASE_DATA_DIR}/pdb70 \ --pdb70_database_path $BASE_DATA_DIR/pdb70 \
--uniclust30_database_path ${BASE_DATA_DIR}/uniclust30/uniclust30_2018_08/uniclust30_2018_08 \ --uniclust30_database_path $BASE_DATA_DIR/uniclust30/uniclust30_2018_08/uniclust30_2018_08 \
--output_dir ${OUTPUT_DIR}/output2 \ --bfd_database_path $BASE_DATA_DIR/bfd/bfd_metaclust_clu_complete_id30_c90_final_seq.sorted_opt \
--bfd_database_path ${BASE_DATA_DIR}/bfd/bfd_metaclust_clu_complete_id30_c90_final_seq.sorted_opt \ --model_device "cuda:0"
--model_device "cuda:0" \
``` ```
**Required arguments:** **Required arguments:**
- `--output_dir`: specify the output directory - `--output_dir`: specify the output directory
- `${INPUT_FASTA_DIR}`: Directory of query fasta files, one sequence per file. An example input file is provided under `examples/monomer_inference` - `$INPUT_FASTA_DIR`: Directory of query fasta files, one sequence per file,e.g. `examples/monomer/fasta_dir`
- `${TEMPLATE_MMCIF_DIR}`: MMCIF files to use for template matching. This directory is required even if using template free inference. - `$TEMPLATE_MMCIF_DIR`: MMCIF files to use for template matching. This directory is required even if using template free inference.
- `*_database_path`: Paths to sequence databases for sequence alignments. Instructions on how to download the sequence databases (Uniref90, Mgnify, PDB70, Uniclust, BFD) are provided in [[OpenFold Dataset Download Instructions]]. - `*_database_path`: Paths to sequence databases for sequence alignment.
- `--model_device`: Specify to use a GPU is one is available. - `--model_device`: Specify to use a GPU is one is available.
#### Model inference with pre-computed alignments #### Model inference with pre-computed alignments
...@@ -82,14 +82,14 @@ To perform model inference with pre-computed alignments, use the following comma ...@@ -82,14 +82,14 @@ To perform model inference with pre-computed alignments, use the following comma
``` ```
python3 run_pretrained_openfold.py ${INPUT_FASTA_DIR} \ python3 run_pretrained_openfold.py ${INPUT_FASTA_DIR} \
${TEMPLATE_MMCIF_DIR} \ $TEMPLATE_MMCIF_DIR \
--output_dir ${OUTPUT_DIR} \ --output_dir $OUTPUT_DIR \
--use_precomputed_alignments ${PRECOMPUTED_ALIGNMENTS} \ --use_precomputed_alignments $PRECOMPUTED_ALIGNMENTS \
--config_preset model_1_ptm \ --config_preset model_1_ptm \
--model_device "cuda:0" \ --model_device "cuda:0" \
``` ```
where `${PRECOMPUTED_ALIGNMENTS}` is a directory that contains alignments. A sample alignments directory structure for a single query is: where `$PRECOMPUTED_ALIGNMENTS` is a directory that contains alignments. A sample alignments directory structure for a single query is:
``` ```
alignments alignments
...@@ -100,7 +100,7 @@ alignments ...@@ -100,7 +100,7 @@ alignments
   └── uniref90_hits.sto    └── uniref90_hits.sto
``` ```
`bfd_uniclust_hits.a3m`, `mgnify_hits.sto`, and `uniref90_hits.sto` are all alignments of the query structure against the BFD, Mgnify, and Uniref90 datasets respsectively. `hhsearch_output.hhr` contains hits against the PDB70 database used for template matching. `bfd_uniclust_hits.a3m`, `mgnify_hits.sto`, and `uniref90_hits.sto` are all alignments of the query structure against the BFD, Mgnify, and Uniref90 datasets respsectively. `hhsearch_output.hhr` contains hits against the PDB70 database used for template matching. The example directory `examples/monomer/alignments` shows examples of expected directories.
#### Configuration settings for template modeling / pTM scoring #### Configuration settings for template modeling / pTM scoring
......
This source diff could not be displayed because it is too large. You can view the blob instead.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
>6KWC_1
GSTIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGEFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVQGYFSSGSASITVS
#!/bin/bash
export LD_LIBRARY_PATH=$CONDA_PREFIX/lib:$LD_LIBRARY_PATH
export LIBRARY_PATH=$CONDA_PREFIX/lib:$LIBRARY_PATH
export FASTA_DIR=./fasta_dir
export OUTPUT_DIR=./
export PRECOMPUTED_ALIGNMENT_DIR=./alignments
export MMCIF_DIR=/mmcifs # UPDATE with path to your mmcifs directory
python3 run_pretrained_openfold.py $FASTA_DIR \
$MMCIF_DIR \
--output_dir $OUTPUT_DIR \
--config_preset model_1_ptm \
--model_device "cuda:0" \
--data_random_seed 42 \
--use_precomputed_alignments $PRECOMPUTED_ALIGNMENT_DIR
This source diff could not be displayed because it is too large. You can view the blob instead.
Markdown is supported
0% or .
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment