"vscode:/vscode.git/clone" did not exist on "0b58bdead5ecbdd221d06813eb62021de07fb94c"
Commit a4000358 authored by Geoffrey Yu's avatar Geoffrey Yu
Browse files

added small test, train, and validation alignment files

parent 510b12f7
>2Q2K_B
MGSSHHHHHHSSGLVPGSHMDKKETKHLLKIKKEDYPQIFDFLENVPRGTKTAHIREALRRYIEEIGENP
>UniRef100_A0A7H4EXK9 Plasmid segregation protein ParR n=1 Tax=Staphylococcus aureus TaxID=1280 RepID=A0A7H4EXK9_STAAU
-------------------MKKKETQHLLKIKKEDYPQIFDFLEGLPRGTKTAHIREALLRYIADEGENP
>UniRef100_UPI0009836679 plasmid segregation protein ParR n=1 Tax=Staphylococcus aureus TaxID=1280 RepID=UPI0009836679
-------------------MDKKETQHLLKIKKQDYPQIFNFLEGLPKGTKTAHIREALMRYIAEEGQNP
>tr|A0A0Q9XW80|A0A0Q9XW80_9STAP Uncharacterized protein OS=Staphylococcus sp. NAM3COL9 GN=ACA31_00310 PE=4 SV=1
-------------------MSKQETNHLLKIKKKDYPQIFEFLEGVPKGTKTAHIREALLRYIEELGAPP
>tr|A0A1E5U0W4|A0A1E5U0W4_STAXY Uncharacterized protein OS=Staphylococcus xylosus GN=AST15_04830 PE=4 SV=1
-------------------MSKQETNHLLKIKKKDYPQIFDFLENVPKGTKTAHIREALIRYINDLGDTpP
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
Markdown is supported
0% or .
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment