"deploy/dynemo/api-server/api/controllers/version.go" did not exist on "14ce7e03bedde2b7632fa526a01a187f4b374996"
Commit 39d67ba5 authored by Dingquan Yu's avatar Dingquan Yu
Browse files

remove unnecessary test files

parent 173f055e
>2Q2K_B
MGSSHHHHHHSSGLVPGSHMDKKETKHLLKIKKEDYPQIFDFLENVPRGTKTAHIREALRRYIEEIGENP
>UniRef100_A0A7H4EXK9 Plasmid segregation protein ParR n=1 Tax=Staphylococcus aureus TaxID=1280 RepID=A0A7H4EXK9_STAAU
-------------------MKKKETQHLLKIKKEDYPQIFDFLEGLPRGTKTAHIREALLRYIADEGENP
>UniRef100_UPI0009836679 plasmid segregation protein ParR n=1 Tax=Staphylococcus aureus TaxID=1280 RepID=UPI0009836679
-------------------MDKKETQHLLKIKKQDYPQIFNFLEGLPKGTKTAHIREALMRYIAEEGQNP
>tr|A0A0Q9XW80|A0A0Q9XW80_9STAP Uncharacterized protein OS=Staphylococcus sp. NAM3COL9 GN=ACA31_00310 PE=4 SV=1
-------------------MSKQETNHLLKIKKKDYPQIFEFLEGVPKGTKTAHIREALLRYIEELGAPP
>tr|A0A1E5U0W4|A0A1E5U0W4_STAXY Uncharacterized protein OS=Staphylococcus xylosus GN=AST15_04830 PE=4 SV=1
-------------------MSKQETNHLLKIKKKDYPQIFDFLENVPKGTKTAHIREALIRYINDLGDTpP
This diff is collapsed.
This diff is collapsed.
Markdown is supported
0% or .
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment